General Information

  • ID:  hor004167
  • Uniprot ID:  Q91WW1
  • Protein name:  Urocortin-2
  • Gene name:  UCN2
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  anterior and intermediate lobes of the pituitary; adrenal cortex and medulla
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0042562 hormone binding; GO:0051429 corticotropin-releasing hormone receptor binding; GO:0051431 corticotropin-releasing hormone receptor 2 binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007586 digestion; GO:0009755 hormone-mediated signaling pathway; GO:0010629 negative regulation of gene expression; GO:0031669 cellular response to nutrient levels; GO:0033685 negative regulation of luteinizing hormone secretion; GO:0035902 response to immobilization stress; GO:0042246 tissue regeneration; GO:0046882 negative regulation of follicle-stimulating hormone secretion; GO:0071385 cellular response to glucocorticoid stimulus; GO:0071456 cellular response to hypoxia
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  VILSLDVPIGLLRILLEQARNKAARNQAATNAQILARV
  • Length:  38(69-106)
  • Propeptide:  MTRWALVVFMVLMLDRVPGTPIPTFQLLPQNYPETTPSSVSSESPSDTTTGPSASWSNSKASPYLDTRVILSLDVPIGLLRILLEQARNKAARNQAATNAQILARVGRR
  • Signal peptide:  MTRWALVVFMVLMLDRVPGTPI
  • Modification:  T38 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Play a major role in the regulatory mechanisms that underlie the neural control of gastric motility;modulate electrical remodeling of the myocardium and hemodynamics
  • Mechanism:  Induced accumulation of intracellular cAMP via corticotropin-releasing factor receptor type 2beta and also caused a significant increase in IL-6 output levels.
  • Cross BBB:  YES
  • Target:  Crhr2, Crhr1
  • Target Unid:   P47866, P35353
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q91WW1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004167_AF2.pdbhor004167_ESM.pdb

Physical Information

Mass: 478410 Formula: C182H321N57O51
Absent amino acids: CFHMWY Common amino acids: AL
pI: 12.05 Basic residues: 5
Polar residues: 6 Hydrophobic residues: 21
Hydrophobicity: 43.16 Boman Index: -4342
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 154.21
Instability Index: 4693.42 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12746280
  • Title:  Urocortin-related Peptides Increase interleukin-6 Output via Cyclic Adenosine 5'-monophosphate-dependent Pathways in A7r5 Aortic Smooth Muscle Cells.
  • PubMed ID:  16159378
  • Title:  Distribution of Urocortin 2 in Various Tissues of the Rat
  • PubMed ID:  16337313
  • Title:  Endogenous Expression and in Vitro Study of C
  • PubMed ID:  25712670
  • Title: