HORDB

General Information

ID: hor004167
Uniprot ID: Q91WW1
Protein name: Urocortin-2
Gene name: UCN2
Organism: Rattus norvegicus (Rat)
Family: Sauvagine/corticotropin-releasing factor/urotensin I family
Source: animal
Expression: anterior and intermediate lobes of the pituitary; adrenal cortex and medulla
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0042562 hormone binding; GO:0051429 corticotropin-releasing hormone receptor binding; GO:0051431 corticotropin-releasing hormone receptor 2 binding
GO BP: GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007586 digestion; GO:0009755 hormone-mediated signaling pathway; GO:0010629 negative regulation of gene expression; GO:0031669 cellular response to nutrient levels; GO:0033685 negative regulation of luteinizing hormone secretion; GO:0035902 response to immobilization stress; GO:0042246 tissue regeneration; GO:0046882 negative regulation of follicle-stimulating hormone secretion; GO:0071385 cellular response to glucocorticoid stimulus; GO:0071456 cellular response to hypoxia
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: VILSLDVPIGLLRILLEQARNKAARNQAATNAQILARV
Length: 38
Propeptide: MTRWALVVFMVLMLDRVPGTPIPTFQLLPQNYPETTPSSVSSESPSDTTTGPSASWSNSKASPYLDTRVILSLDVPIGLLRILLEQARNKAARNQAATNAQILARVGRR
Signal peptide: MTRWALVVFMVLMLDRVPGTPI
Modification: T38 Valine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Play a major role in the regulatory mechanisms that underlie the neural control of gastric motility;modulate electrical remodeling of the myocardium and hemodynamics
Mechanism: Induced accumulation of intracellular cAMP via corticotropin-releasing factor receptor type 2beta and also caused a significant increase in IL-6 output levels.
Cross BBB: YES
Target: Crhr2, Crhr1
Target Unid: P47866, P35353
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q91WW1-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004167_AF2.pdb

hor004167_ESM.pdb

Physical Information

Mass:	478410	Formula:	C182H321N57O51
Absent amino acids:	CFHMWY	Common amino acids:	AL
pI:	12.05	Basic residues:	5
Polar residues:	6	Hydrophobic residues:	21
Hydrophobicity:	43.16	Boman Index:	-4342
Half-Life:	100 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	154.21
Instability Index:	4693.42	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

Literature

PubMed ID: 12746280
Title: Urocortin-related Peptides Increase interleukin-6 Output via Cyclic Adenosine 5'-monophosphate-dependent Pathways in A7r5 Aortic Smooth Muscle Cells.
PubMed ID: 16159378
Title: Distribution of Urocortin 2 in Various Tissues of the Rat
PubMed ID: 16337313
Title: Endogenous Expression and in Vitro Study of CRF-related Peptides and CRF Receptors in the Rat Gastric Antrum.
PubMed ID: 25712670
Title: The effects of vasoactive peptide urocortin 2 on hemodynamics in spontaneous hypertensive rat and the role of L-type calcium channel and CRFR2.